PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010108453.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family LBD
Protein Properties Length: 230aa    MW: 24924.5 Da    PI: 7.1205
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010108453.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.71.7e-42781771100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l+++pe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+a+la
  XP_010108453.1  78 PCAACKILRRRCVDKCVLAPYFPPTEPLKFTIAHRVFGASNIIKFLQEIPESQRADAVSSMVYEANARIRDPVYGCAGAICQLQKQVSELQAQLA 172
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_010108453.1 173 KAQAE 177
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.01177178IPR004883Lateral organ boundaries, LOB
PfamPF031957.9E-4378175IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MEFKGKAPTL PRITVPAPFS SSHSPPSSSS PTPNSSQLSS PTTTFPSPPN SYQSSPTSAV  60
TPVPLPPPPP PPPVVLSPCA ACKILRRRCV DKCVLAPYFP PTEPLKFTIA HRVFGASNII  120
KFLQEIPESQ RADAVSSMVY EANARIRDPV YGCAGAICQL QKQVSELQAQ LAKAQAELVN  180
MQCQQANLIA LICMDMTQLQ EPNSQQQPYG DTSCFLDDNT LGTTWEPLWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010108453.11e-167hypothetical protein L484_014124
SwissprotQ9LQR02e-77LBD1_ARATH; LOB domain-containing protein 1
TrEMBLW9RZL71e-167W9RZL7_9R
STRINGPOPTR_0008s04350.19e-99(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-63LOB domain-containing protein 1